PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G73410.1
Common NameATMYB54, MYB54, T9L24.38
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 243aa    MW: 28204.8 Da    PI: 10.1761
Description myb domain protein 54
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G73410.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.2e-19651147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l+d+v+q+G+++W++Ia +++ gR++k+c++rw++ 
      AT1G73410.1  6 RGHWRPAEDEKLKDLVEQYGPHNWNAIALKLP-GRSGKSCRLRWFNQ 51
                     899*****************************.***********996 PP

2Myb_DNA-binding60.53.5e-1958101146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++T+eE+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ 
      AT1G73410.1  58 RNPFTEEEEERLLAAHRIHGNR-WSIIARLFP-GRTDNAVKNHWHV 101
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.692152IPR017930Myb domain
SMARTSM007171.1E-15554IPR001005SANT/Myb domain
PfamPF002492.0E-17651IPR001005SANT/Myb domain
SuperFamilySSF466893.59E-30699IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-27759IPR009057Homeodomain-like
CDDcd001678.16E-15950No hitNo description
PROSITE profilePS5129426.37953107IPR017930Myb domain
SMARTSM007171.9E-1657105IPR001005SANT/Myb domain
PfamPF002498.0E-1658100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2160106IPR009057Homeodomain-like
CDDcd001671.25E-769100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000272anatomyprotoxylem
PO:0005352anatomyxylem
PO:0005848anatomysecondary xylem
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MIMCSRGHWR PAEDEKLKDL VEQYGPHNWN AIALKLPGRS GKSCRLRWFN QLDPRINRNP  60
FTEEEEERLL AAHRIHGNRW SIIARLFPGR TDNAVKNHWH VIMARRTRQT SKPRLLPSTT  120
SSSSLMASEQ IMMSSGGYNH NYSSDDRKKI FPADFINFPY KFSHINHLHF LKEFFTGKIA  180
LNHKANQSKK PMEFYNFLQV NTDSNKSEII DQDSGQSKRS DSDTKHESHV PFFDFLSVGN  240
SAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-3231071105C-Myb DNA-Binding Domain
1mse_C5e-3231071105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.109100.0root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306989350.0
Genevisible245735_at0.0
Expression AtlasAT1G73410-
AtGenExpressAT1G73410-
ATTED-IIAT1G73410-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor that is a member of the R2R3-MYB family.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G73410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G32770 (A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G73410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2274020.0AK227402.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-06-B21.
GenBankAY5195690.0AY519569.1 Arabidopsis thaliana MYB transcription factor (At1g73410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177484.10.0myb domain protein 54
TrEMBLQ9FX360.0Q9FX36_ARATH; At1g73410
STRINGAT1G73410.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  6. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  7. Zhong R,Ye ZH
    MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes.
    Plant Cell Physiol., 2012. 53(2): p. 368-80
    [PMID:22197883]
  8. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  9. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]